|
Beyotime
rabbit polyclonal antibodies against gapdh, hmg-coa, srebp-1c, acc, and ampk-α ![]() Rabbit Polyclonal Antibodies Against Gapdh, Hmg Coa, Srebp 1c, Acc, And Ampk α, supplied by Beyotime, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/rabbit polyclonal antibodies against gapdh, hmg-coa, srebp-1c, acc, and ampk-α/product/Beyotime Average 90 stars, based on 1 article reviews
rabbit polyclonal antibodies against gapdh, hmg-coa, srebp-1c, acc, and ampk-α - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
GenScript corporation
becn1 peptide (tat-becn1, sequence: ygrkkrrqrrrggtnvfnatfeiwhdgefgt) ![]() Becn1 Peptide (Tat Becn1, Sequence: Ygrkkrrqrrrggtnvfnatfeiwhdgefgt), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/becn1 peptide (tat-becn1, sequence: ygrkkrrqrrrggtnvfnatfeiwhdgefgt)/product/GenScript corporation Average 90 stars, based on 1 article reviews
becn1 peptide (tat-becn1, sequence: ygrkkrrqrrrggtnvfnatfeiwhdgefgt) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Beyotime
rabbit monoclonal antibodies against β-actin, akt, p-akt, erk, p-erk, ampk, p-ampk, pen2, and mtor ![]() Rabbit Monoclonal Antibodies Against β Actin, Akt, P Akt, Erk, P Erk, Ampk, P Ampk, Pen2, And Mtor, supplied by Beyotime, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/rabbit monoclonal antibodies against β-actin, akt, p-akt, erk, p-erk, ampk, p-ampk, pen2, and mtor/product/Beyotime Average 90 stars, based on 1 article reviews
rabbit monoclonal antibodies against β-actin, akt, p-akt, erk, p-erk, ampk, p-ampk, pen2, and mtor - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
|
Beyotime
rabbit anti-ampk mab ![]() Rabbit Anti Ampk Mab, supplied by Beyotime, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/rabbit anti-ampk mab/product/Beyotime Average 90 stars, based on 1 article reviews
rabbit anti-ampk mab - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Marine Drugs
Article Title: Effect of Marine Microalga Chlorella pyrenoidosa Ethanol Extract on Lipid Metabolism and Gut Microbiota Composition in High-Fat Diet-Fed Rats
doi: 10.3390/md16120498
Figure Lengend Snippet: Effect of CPE55 on the mRNA and protein expressions levels in the liver. The mRNA expression ( A ) and protein expression ( B , C ) of Acetyl CoA carboxylase (ACC), AMPK-α, 3-Hydroxy-3-methyl glutaryl coenzyme A reductase (HMG-CoA), and Sterol regulatory element-binding transcription factor-1c (SREBP-1c) levels were determined through real-time quantitative PCR (RT-qPCR) and western blotting analysis. Data are expressed as the mean ± SD. One-way ANOVA with Tukey’s test. * p < 0.05 and ** p < 0.01 for CPE55 versus NFD; # p < 0.05, ## p < 0.01 for CPE55 versus HFD.
Article Snippet: The membranes were incubated for 3.5 h at 37 °C using rabbit polyclonal antibodies against GAPDH, HMG-CoA, SREBP-1c, ACC, and
Techniques: Expressing, Binding Assay, Real-time Polymerase Chain Reaction, Quantitative RT-PCR, Western Blot